Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapC-mazE/PIN(toxin)
Location 757033..757825 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID P9WFB2
Locus tag JOA04_RS03470 Protein ID WP_003403386.1
Coordinates 757388..757825 (-) Length 146 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID G0TQE0
Locus tag JOA04_RS03465 Protein ID WP_003403381.1
Coordinates 757033..757278 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS03435 752053..753558 + 1506 WP_003403360.1 carotenoid cleavage oxygenase -
JOA04_RS03440 753639..754649 + 1011 WP_003911248.1 ABC transporter ATP-binding protein -
JOA04_RS03445 755037..755420 - 384 WP_003403365.1 ribonuclease VapC6 -
JOA04_RS03450 755515..755670 - 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin -
JOA04_RS03455 755746..756462 - 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
JOA04_RS03460 756738..757046 - 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
JOA04_RS03465 757033..757278 - 246 WP_003403381.1 ribbon-helix-helix protein, CopG family Antitoxin
JOA04_RS03470 757388..757825 - 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin Toxin
JOA04_RS03475 757822..758076 - 255 WP_003911263.1 antitoxin VapB7 -
JOA04_RS03480 758190..760553 + 2364 WP_003403397.1 arylsulfatase AtsD -
JOA04_RS03485 760616..760942 + 327 WP_003403401.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
JOA04_RS03490 760854..761192 + 339 WP_003403405.1 PIN domain-containing protein -
JOA04_RS03495 761189..761362 + 174 WP_003898549.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-126)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 146 a.a.        Molecular weight: 15245.39 Da        Isoelectric Point: 5.1865

>T289914 WP_003403386.1 NZ_LR882500:c757825-757388 [Mycobacterium tuberculosis variant microti]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR

Download         Length: 438 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9169.01 Da        Isoelectric Point: 4.2070

>AT289914 WP_003403381.1 NZ_LR882500:c757278-757033 [Mycobacterium tuberculosis variant microti]
MLSFRADDHDVDLADAWARRLHIGRSELLRDALRRHLAALAADQDVQAYTERPLTDDENALAEIADWGPAEDWADWADAA
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSW5

Antitoxin

Source ID Structure
AlphaFold DB G0TQE0

References