Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
| Location | 719545..720209 | Replicon | chromosome |
| Accession | NZ_LR882500 | ||
| Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P96917 |
| Locus tag | JOA04_RS03275 | Protein ID | WP_003403246.1 |
| Coordinates | 719802..720209 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WF18 |
| Locus tag | JOA04_RS03270 | Protein ID | WP_003403244.1 |
| Coordinates | 719545..719805 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JOA04_RS03245 | 715722..716879 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
| JOA04_RS03250 | 716890..717837 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| JOA04_RS03255 | 717930..718184 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
| JOA04_RS03260 | 718184..718579 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
| JOA04_RS03265 | 718673..719413 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
| JOA04_RS03270 | 719545..719805 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| JOA04_RS03275 | 719802..720209 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JOA04_RS03280 | 720281..721432 | - | 1152 | WP_003403248.1 | FIST C-terminal domain-containing protein | - |
| JOA04_RS03285 | 721525..723252 | - | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T289911 WP_003403246.1 NZ_LR882500:719802-720209 [Mycobacterium tuberculosis variant microti]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3DBO |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3DBO | |
| AlphaFold DB | A0A7U4BSE4 |