Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 717930..718579 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | JOA04_RS03260 | Protein ID | WP_003403236.1 |
Coordinates | 718184..718579 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | JOA04_RS03255 | Protein ID | WP_003403235.1 |
Coordinates | 717930..718184 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS03230 | 713055..713138 | + | 84 | Protein_639 | galactose-1-phosphate uridylyltransferase | - |
JOA04_RS03235 | 713157..714239 | + | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
JOA04_RS03240 | 714236..715327 | + | 1092 | WP_003403225.1 | galactokinase | - |
JOA04_RS03245 | 715722..716879 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
JOA04_RS03250 | 716890..717837 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
JOA04_RS03255 | 717930..718184 | + | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
JOA04_RS03260 | 718184..718579 | + | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
JOA04_RS03265 | 718673..719413 | - | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
JOA04_RS03270 | 719545..719805 | + | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
JOA04_RS03275 | 719802..720209 | + | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
JOA04_RS03280 | 720281..721432 | - | 1152 | WP_003403248.1 | FIST C-terminal domain-containing protein | - |
JOA04_RS03285 | 721525..723252 | - | 1728 | WP_003900979.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T289910 WP_003403236.1 NZ_LR882500:718184-718579 [Mycobacterium tuberculosis variant microti]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ | |
AlphaFold DB | A0A7U4BSC2 |