Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 704754..705397 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag JOA04_RS03175 Protein ID WP_003403187.1
Coordinates 704996..705397 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag JOA04_RS03170 Protein ID WP_003403184.1
Coordinates 704754..704999 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS03135 700034..700564 - 531 WP_003917320.1 two component system sensor kinase HK2 -
JOA04_RS03140 700548..701243 - 696 WP_003918099.1 two-component system response regulator TcrA -
JOA04_RS03145 701366..701677 + 312 WP_003403164.1 hypothetical protein -
JOA04_RS03150 701749..702699 + 951 WP_003907436.1 DUF1259 domain-containing protein -
JOA04_RS03155 702940..703524 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
JOA04_RS03160 703526..704239 + 714 Protein_625 IS607 family element transposase accessory protein TnpB -
JOA04_RS03165 704239..704709 + 471 WP_003898523.1 hypothetical protein -
JOA04_RS03170 704754..704999 + 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
JOA04_RS03175 704996..705397 + 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
JOA04_RS03180 705785..705952 - 168 WP_077385191.1 DUF3800 domain-containing protein -
JOA04_RS03185 705985..706182 - 198 WP_003403191.1 hypothetical protein -
JOA04_RS03190 706262..707419 - 1158 WP_003403193.1 hypothetical protein -
JOA04_RS03195 707471..707692 - 222 WP_003898525.1 DUF4926 domain-containing protein -
JOA04_RS03200 707834..708439 + 606 WP_105799909.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T289908 WP_003403187.1 NZ_LR882500:704996-705397 [Mycobacterium tuberculosis variant microti]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT289908 WP_003403184.1 NZ_LR882500:704754-704999 [Mycobacterium tuberculosis variant microti]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References