Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/AbrB(antitoxin) |
| Location | 698664..699310 | Replicon | chromosome |
| Accession | NZ_LR882500 | ||
| Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ88 |
| Locus tag | JOA04_RS03120 | Protein ID | WP_003403137.1 |
| Coordinates | 698664..699077 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TQ89 |
| Locus tag | JOA04_RS03125 | Protein ID | WP_003403139.1 |
| Coordinates | 699074..699310 (-) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JOA04_RS03100 | 694747..696297 | + | 1551 | WP_003403119.1 | MCE family protein | - |
| JOA04_RS03105 | 696349..696741 | - | 393 | WP_003403122.1 | type II toxin-antitoxin system toxin ribonuclease C4 | - |
| JOA04_RS03110 | 696738..696995 | - | 258 | WP_003403125.1 | type II toxin-antitoxin system antitoxin VapB4 | - |
| JOA04_RS03115 | 697178..698413 | - | 1236 | WP_003403128.1 | ATP-binding protein | - |
| JOA04_RS03120 | 698664..699077 | - | 414 | WP_003403137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JOA04_RS03125 | 699074..699310 | - | 237 | WP_003403139.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| JOA04_RS03130 | 699414..699920 | - | 507 | WP_003900973.1 | two component system sensor kinase HK1 | - |
| JOA04_RS03135 | 700034..700564 | - | 531 | WP_003917320.1 | two component system sensor kinase HK2 | - |
| JOA04_RS03140 | 700548..701243 | - | 696 | WP_003918099.1 | two-component system response regulator TcrA | - |
| JOA04_RS03145 | 701366..701677 | + | 312 | WP_003403164.1 | hypothetical protein | - |
| JOA04_RS03150 | 701749..702699 | + | 951 | WP_003907436.1 | DUF1259 domain-containing protein | - |
| JOA04_RS03155 | 702940..703524 | + | 585 | WP_003403171.1 | IS607-like element IS1536 family transposase | - |
| JOA04_RS03160 | 703526..704239 | + | 714 | Protein_625 | IS607 family element transposase accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14786.14 Da Isoelectric Point: 8.1405
>T289907 WP_003403137.1 NZ_LR882500:c699077-698664 [Mycobacterium tuberculosis variant microti]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|