Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 698664..699310 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag JOA04_RS03120 Protein ID WP_003403137.1
Coordinates 698664..699077 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag JOA04_RS03125 Protein ID WP_003403139.1
Coordinates 699074..699310 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS03100 694747..696297 + 1551 WP_003403119.1 MCE family protein -
JOA04_RS03105 696349..696741 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
JOA04_RS03110 696738..696995 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
JOA04_RS03115 697178..698413 - 1236 WP_003403128.1 ATP-binding protein -
JOA04_RS03120 698664..699077 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
JOA04_RS03125 699074..699310 - 237 WP_003403139.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JOA04_RS03130 699414..699920 - 507 WP_003900973.1 two component system sensor kinase HK1 -
JOA04_RS03135 700034..700564 - 531 WP_003917320.1 two component system sensor kinase HK2 -
JOA04_RS03140 700548..701243 - 696 WP_003918099.1 two-component system response regulator TcrA -
JOA04_RS03145 701366..701677 + 312 WP_003403164.1 hypothetical protein -
JOA04_RS03150 701749..702699 + 951 WP_003907436.1 DUF1259 domain-containing protein -
JOA04_RS03155 702940..703524 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
JOA04_RS03160 703526..704239 + 714 Protein_625 IS607 family element transposase accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T289907 WP_003403137.1 NZ_LR882500:c699077-698664 [Mycobacterium tuberculosis variant microti]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT289907 WP_003403139.1 NZ_LR882500:c699310-699074 [Mycobacterium tuberculosis variant microti]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References