Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-PHD
Location 696349..696995 Replicon chromosome
Accession NZ_LR882500
Organism Mycobacterium tuberculosis variant microti strain 94-2272 isolate human

Toxin (Protein)


Gene name vapC Uniprot ID O07783
Locus tag JOA04_RS03105 Protein ID WP_003403122.1
Coordinates 696349..696741 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ86
Locus tag JOA04_RS03110 Protein ID WP_003403125.1
Coordinates 696738..696995 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JOA04_RS03090 692011..693537 + 1527 WP_003403112.1 virulence factor Mce family protein -
JOA04_RS03095 693600..694742 + 1143 WP_193441967.1 virulence factor Mce family protein -
JOA04_RS03100 694747..696297 + 1551 WP_003403119.1 MCE family protein -
JOA04_RS03105 696349..696741 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 Toxin
JOA04_RS03110 696738..696995 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 Antitoxin
JOA04_RS03115 697178..698413 - 1236 WP_003403128.1 ATP-binding protein -
JOA04_RS03120 698664..699077 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin -
JOA04_RS03125 699074..699310 - 237 WP_003403139.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JOA04_RS03130 699414..699920 - 507 WP_003900973.1 two component system sensor kinase HK1 -
JOA04_RS03135 700034..700564 - 531 WP_003917320.1 two component system sensor kinase HK2 -
JOA04_RS03140 700548..701243 - 696 WP_003918099.1 two-component system response regulator TcrA -
JOA04_RS03145 701366..701677 + 312 WP_003403164.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(8-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(3-53)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14080.08 Da        Isoelectric Point: 4.6558

>T289906 WP_003403122.1 NZ_LR882500:c696741-696349 [Mycobacterium tuberculosis variant microti]
VNVRRALADTSVFIGIEATRFDPDRFAGYEWGVSVVTLGELRLGVLQASGPEAAARRLSTYQLAQRFEPLGIDEAVSEAW
ALLVSKLRAAKLRVPINDSWIAATAVAHGIAILTQDNDYAAMPDVEVITI

Download         Length: 393 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9681.06 Da        Isoelectric Point: 7.0175

>AT289906 WP_003403125.1 NZ_LR882500:c696995-696738 [Mycobacterium tuberculosis variant microti]
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTT
DDVRW

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4F8V4

Antitoxin

Source ID Structure
AlphaFold DB G0TQ86

References