Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 71680..72313 | Replicon | chromosome |
Accession | NZ_LR882500 | ||
Organism | Mycobacterium tuberculosis variant microti strain 94-2272 isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFC0 |
Locus tag | JOA04_RS00360 | Protein ID | WP_003400580.1 |
Coordinates | 71912..72313 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P0CW29 |
Locus tag | JOA04_RS00355 | Protein ID | WP_003400577.1 |
Coordinates | 71680..71919 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JOA04_RS00340 | 66977..68416 | + | 1440 | WP_105799815.1 | FAD-binding oxidoreductase | - |
JOA04_RS00345 | 68472..68633 | + | 162 | WP_003899796.1 | hypothetical protein | - |
JOA04_RS00350 | 68674..71613 | + | 2940 | Protein_65 | UPF0182 family protein | - |
JOA04_RS00355 | 71680..71919 | + | 240 | WP_003400577.1 | antitoxin VapB1 | Antitoxin |
JOA04_RS00360 | 71912..72313 | + | 402 | WP_003400580.1 | type II toxin-antitoxin system ribonuclease VapC1 | Toxin |
JOA04_RS00365 | 72365..74602 | - | 2238 | WP_003400583.1 | NADP-dependent isocitrate dehydrogenase | - |
JOA04_RS00370 | 74720..75289 | - | 570 | WP_003400591.1 | TetR/AcrR family transcriptional regulator; helix-turn-helix transcriptional regulator | - |
JOA04_RS00375 | 75392..76303 | + | 912 | WP_003899798.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14339.44 Da Isoelectric Point: 4.8887
>T289900 WP_003400580.1 NZ_LR882500:71912-72313 [Mycobacterium tuberculosis variant microti]
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
VDECVVDAAAVVDALAGKGASAIVLRGLLKESISNAPHLLDAEVGHALRRAVLSDEISEEQARAALDALPYLIDNRYPHS
PRLIEYTWQLRHNVTFYDALYVALATALDVPLLTGDSRLAAAPGLPCEIKLVR
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BR82 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHM7 |