Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-PHD |
| Location | 3803577..3804262 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TIR9 |
| Locus tag | JN986_RS17655 | Protein ID | WP_003417998.1 |
| Coordinates | 3803852..3804262 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | JN986_RS17650 | Protein ID | WP_003912220.1 |
| Coordinates | 3803577..3803855 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS17630 | 3799566..3801167 | - | 1602 | WP_003417969.1 | FAD/NAD(P)-binding protein | - |
| JN986_RS17635 | 3801184..3801888 | - | 705 | WP_202592823.1 | dTDP-4-amino-4,6-dideoxyglucose formyltransferase | - |
| JN986_RS17640 | 3802006..3802572 | - | 567 | WP_003417984.1 | TetR/AcrR family transcriptional regulator | - |
| JN986_RS17645 | 3802634..3803521 | + | 888 | WP_003900050.1 | alpha-ketoglutarate-dependent sulfate ester dioxygenase | - |
| JN986_RS17650 | 3803577..3803855 | + | 279 | WP_003912220.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| JN986_RS17655 | 3803852..3804262 | + | 411 | WP_003417998.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN986_RS17660 | 3804295..3806031 | - | 1737 | WP_003418002.1 | cholesterol oxidase | - |
| JN986_RS17665 | 3806087..3807214 | - | 1128 | WP_003418005.1 | GuaB3 family IMP dehydrogenase-related protein | - |
| JN986_RS17670 | 3807234..3808823 | - | 1590 | WP_003900682.1 | IMP dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14695.84 Da Isoelectric Point: 5.1784
>T289899 WP_003417998.1 NZ_LR882499:3803852-3804262 [Mycobacterium tuberculosis variant microti OV254]
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
VIYMDTSALTKLLISEPETTELRTWLTAQSGQGEDAATSTLGRVELMRVVARYGQPGQTERARYLLDGLDILPLTEPVIG
LAETIGPATLRSLDAIHLAAAAQIKRELTAFVTYDHRLLSGCREVGFVTASPGAVR
Download Length: 411 bp
Antitoxin
Download Length: 93 a.a. Molecular weight: 10280.75 Da Isoelectric Point: 10.1819
>AT289899 WP_003912220.1 NZ_LR882499:3803577-3803855 [Mycobacterium tuberculosis variant microti OV254]
VEAIGIRELRQHASRYLARVEAGEELGVTNKGRLVARLIPVQAAERSREALIESGVLIPARRPQNLLDVTAEPARGRKRT
LSDVLNEMRDEQ
VEAIGIRELRQHASRYLARVEAGEELGVTNKGRLVARLIPVQAAERSREALIESGVLIPARRPQNLLDVTAEPARGRKRT
LSDVLNEMRDEQ
Download Length: 279 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|