Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Txe-YefM |
| Location | 3749297..3749826 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TI95 |
| Locus tag | JN986_RS17415 | Protein ID | WP_003417760.1 |
| Coordinates | 3749569..3749826 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0TI94 |
| Locus tag | JN986_RS17410 | Protein ID | WP_003417757.1 |
| Coordinates | 3749297..3749572 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS17390 | 3746095..3747532 | - | 1438 | Protein_3434 | FAD-binding oxidoreductase | - |
| JN986_RS17395 | 3747635..3748024 | + | 390 | WP_003417745.1 | DUF732 domain-containing protein | - |
| JN986_RS17400 | 3748038..3748331 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
| JN986_RS17405 | 3748328..3749173 | - | 846 | WP_003417751.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
| JN986_RS17410 | 3749297..3749572 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
| JN986_RS17415 | 3749569..3749826 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
| JN986_RS17420 | 3749868..3751058 | + | 1191 | WP_003900033.1 | NADH:flavin oxidoreductase | - |
| JN986_RS17425 | 3751175..3751543 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
| JN986_RS17430 | 3751540..3752091 | - | 552 | WP_105799777.1 | pentapeptide repeat protein MfpA | - |
| JN986_RS17435 | 3752098..3752679 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
| JN986_RS17440 | 3752660..3753028 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
| JN986_RS17445 | 3753006..3753398 | - | 393 | WP_003417776.1 | roadblock/LC7 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T289897 WP_003417760.1 NZ_LR882499:3749569-3749826 [Mycobacterium tuberculosis variant microti OV254]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Download Length: 92 a.a. Molecular weight: 10194.35 Da Isoelectric Point: 4.6652
>AT289897 WP_003417757.1 NZ_LR882499:3749297-3749572 [Mycobacterium tuberculosis variant microti OV254]
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSV
DELREMAGGEE
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSV
DELREMAGGEE
Download Length: 276 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|