Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3698702..3699376 | Replicon | chromosome |
Accession | NZ_LR882499 | ||
Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JN986_RS17245 | Protein ID | WP_105799814.1 |
Coordinates | 3698702..3699130 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | JN986_RS17250 | Protein ID | WP_003417286.1 |
Coordinates | 3699134..3699376 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN986_RS17220 | 3694524..3694925 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
JN986_RS17225 | 3695066..3695500 | + | 435 | WP_003900017.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
JN986_RS17230 | 3695497..3695931 | + | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
JN986_RS17235 | 3696060..3697832 | + | 1773 | WP_202592819.1 | succinate dehydrogenase flavoprotein subunit | - |
JN986_RS17240 | 3697832..3698623 | + | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
JN986_RS17245 | 3698702..3699130 | - | 429 | WP_105799814.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN986_RS17250 | 3699134..3699376 | - | 243 | WP_003417286.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JN986_RS17255 | 3699498..3700112 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
JN986_RS17260 | 3700109..3700774 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
JN986_RS17265 | 3700775..3701308 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
JN986_RS17270 | 3701305..3701679 | - | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
JN986_RS17275 | 3701776..3702840 | - | 1065 | WP_003913037.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15751.08 Da Isoelectric Point: 8.3191
>T289896 WP_105799814.1 NZ_LR882499:c3699130-3698702 [Mycobacterium tuberculosis variant microti OV254]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGCASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGCASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|