Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3172134..3172821 | Replicon | chromosome |
Accession | NZ_LR882499 | ||
Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P65044 |
Locus tag | JN986_RS14900 | Protein ID | WP_003414624.1 |
Coordinates | 3172378..3172821 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TFH0 |
Locus tag | JN986_RS14895 | Protein ID | WP_003414620.1 |
Coordinates | 3172134..3172391 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN986_RS14875 | 3167454..3168308 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
JN986_RS14880 | 3168364..3169527 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
JN986_RS14885 | 3169544..3170758 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
JN986_RS14890 | 3170766..3172007 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
JN986_RS14895 | 3172134..3172391 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JN986_RS14900 | 3172378..3172821 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN986_RS14905 | 3172901..3173563 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
JN986_RS14910 | 3173659..3173850 | + | 192 | WP_105799616.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
JN986_RS14915 | 3174182..3175930 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
JN986_RS14920 | 3176026..3176607 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
JN986_RS14925 | 3176707..3176973 | + | 267 | WP_031652375.1 | DUF2631 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T289894 WP_003414624.1 NZ_LR882499:3172378-3172821 [Mycobacterium tuberculosis variant microti OV254]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|