Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3166533..3167081 | Replicon | chromosome |
Accession | NZ_LR882499 | ||
Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | JN986_RS14870 | Protein ID | WP_003414602.1 |
Coordinates | 3166818..3167081 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | JN986_RS14865 | Protein ID | WP_003414599.1 |
Coordinates | 3166533..3166814 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN986_RS14840 | 3162156..3163013 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
JN986_RS14845 | 3163055..3163639 | - | 585 | WP_003414585.1 | DUF1707 domain-containing protein | - |
JN986_RS14850 | 3163743..3163991 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
JN986_RS14855 | 3163988..3164368 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
JN986_RS14860 | 3164450..3166261 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
JN986_RS14865 | 3166533..3166814 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
JN986_RS14870 | 3166818..3167081 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JN986_RS14875 | 3167454..3168308 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
JN986_RS14880 | 3168364..3169527 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
JN986_RS14885 | 3169544..3170758 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
JN986_RS14890 | 3170766..3172007 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T289893 WP_003414602.1 NZ_LR882499:3166818-3167081 [Mycobacterium tuberculosis variant microti OV254]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Download Length: 94 a.a. Molecular weight: 10183.40 Da Isoelectric Point: 4.3440
>AT289893 WP_003414599.1 NZ_LR882499:3166533-3166814 [Mycobacterium tuberculosis variant microti OV254]
MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGED
EIRAEFGVPRRPH
MRILPISTIKGKLNEFVDAVSSTQDQITITKNGAPAAVLVGADEWESLQETLYWLAQPGIRESIAEADADIASGRTYGED
EIRAEFGVPRRPH
Download Length: 282 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|