Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN_Sll0205-like-Phd |
| Location | 3125616..3126220 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P71623 |
| Locus tag | JN986_RS14670 | Protein ID | WP_003414492.1 |
| Coordinates | 3125616..3126008 (-) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A829CBY8 |
| Locus tag | JN986_RS14675 | Protein ID | WP_003414495.1 |
| Coordinates | 3126005..3126220 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS14640 | 3120766..3121554 | - | 789 | WP_003917092.1 | CRISPR-associated endoribonuclease Cas6 | - |
| JN986_RS14645 | 3121888..3122433 | - | 546 | WP_003904931.1 | DUF1802 family protein | - |
| JN986_RS14650 | 3122705..3123589 | - | 885 | WP_003414409.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| JN986_RS14655 | 3123592..3124479 | - | 888 | WP_003414414.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| JN986_RS14660 | 3124784..3125329 | - | 546 | WP_003899500.1 | DUF1802 family protein | - |
| JN986_RS14665 | 3125326..3125595 | - | 270 | WP_003414489.1 | DUF2277 family protein | - |
| JN986_RS14670 | 3125616..3126008 | - | 393 | WP_003414492.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN986_RS14675 | 3126005..3126220 | - | 216 | WP_003414495.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| JN986_RS14680 | 3126267..3127016 | + | 750 | WP_003414497.1 | enoyl-CoA hydratase | - |
| JN986_RS14685 | 3127095..3128177 | - | 1083 | WP_003414499.1 | ABC transporter ATP-binding protein | - |
| JN986_RS14690 | 3128170..3129480 | - | 1311 | WP_003414501.1 | ABC transporter substrate-binding protein | - |
| JN986_RS14695 | 3129483..3130310 | - | 828 | WP_003414504.1 | carbohydrate ABC transporter permease | - |
| JN986_RS14700 | 3130307..3131218 | - | 912 | WP_105799902.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14610.74 Da Isoelectric Point: 6.7594
>T289892 WP_003414492.1 NZ_LR882499:c3126008-3125616 [Mycobacterium tuberculosis variant microti OV254]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BWM8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CBY8 |