Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3065262..3065949 | Replicon | chromosome |
Accession | NZ_LR882499 | ||
Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TF65 |
Locus tag | JN986_RS14330 | Protein ID | WP_003414064.1 |
Coordinates | 3065554..3065949 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TF64 |
Locus tag | JN986_RS14325 | Protein ID | WP_003414061.1 |
Coordinates | 3065262..3065528 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN986_RS14300 | 3060901..3061803 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
JN986_RS14305 | 3061872..3062624 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
JN986_RS14310 | 3062868..3063143 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
JN986_RS14315 | 3063140..3064762 | - | 1623 | WP_003414057.1 | type I restriction-modification system subunit M | - |
JN986_RS14320 | 3064849..3065265 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | - |
JN986_RS14325 | 3065262..3065528 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
JN986_RS14330 | 3065554..3065949 | - | 396 | WP_003414064.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN986_RS14335 | 3065946..3066215 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
JN986_RS14340 | 3066225..3067319 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
JN986_RS14345 | 3067316..3067735 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
JN986_RS14350 | 3067809..3068288 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
JN986_RS14355 | 3068359..3069159 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
JN986_RS14360 | 3069315..3070052 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14340.04 Da Isoelectric Point: 4.7145
>T289889 WP_003414064.1 NZ_LR882499:c3065949-3065554 [Mycobacterium tuberculosis variant microti OV254]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|