Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2926137..2926851 Replicon chromosome
Accession NZ_LR882499
Organism Mycobacterium tuberculosis variant microti OV254 isolate vole

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag JN986_RS13500 Protein ID WP_003413460.1
Coordinates 2926411..2926851 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag JN986_RS13495 Protein ID WP_003413456.1
Coordinates 2926137..2926424 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN986_RS13460 2921559..2921804 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JN986_RS13465 2921801..2922205 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
JN986_RS13470 2922422..2923042 + 621 WP_003413441.1 DUF4178 domain-containing protein -
JN986_RS13475 2923053..2923547 + 495 WP_003413444.1 DUF2617 family protein -
JN986_RS13480 2923544..2923975 + 432 WP_003413445.1 DUF4247 domain-containing protein -
JN986_RS13485 2924000..2924458 + 459 WP_193441927.1 DUF350 domain-containing protein -
JN986_RS13490 2924455..2926026 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
JN986_RS13495 2926137..2926424 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
JN986_RS13500 2926411..2926851 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
JN986_RS13505 2926872..2927627 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
JN986_RS13510 2927760..2928356 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
JN986_RS13515 2928364..2929209 - 846 WP_003413466.1 acyl-CoA thioesterase II -
JN986_RS13520 2929238..2930137 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
JN986_RS13525 2930265..2930939 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T289886 WP_003413460.1 NZ_LR882499:2926411-2926851 [Mycobacterium tuberculosis variant microti OV254]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT289886 WP_003413456.1 NZ_LR882499:2926137-2926424 [Mycobacterium tuberculosis variant microti OV254]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References