Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2864644..2865275 Replicon chromosome
Accession NZ_LR882499
Organism Mycobacterium tuberculosis variant microti OV254 isolate vole

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag JN986_RS13225 Protein ID WP_003413174.1
Coordinates 2864898..2865275 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag JN986_RS13220 Protein ID WP_003413167.1
Coordinates 2864644..2864901 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN986_RS13190 2860558..2860872 + 315 WP_009937839.1 hypothetical protein -
JN986_RS13195 2861168..2862379 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
JN986_RS13200 2862506..2863165 + 660 WP_031719937.1 LppA family lipoprotein -
JN986_RS13205 2863162..2863824 + 663 WP_202592799.1 hypothetical protein -
JN986_RS13210 2863821..2864099 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
JN986_RS13215 2864192..2864605 + 414 WP_003413164.1 PIN domain nuclease -
JN986_RS13220 2864644..2864901 + 258 WP_003413167.1 ribbon-helix-helix domain-containing protein Antitoxin
JN986_RS13225 2864898..2865275 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
JN986_RS13230 2865291..2865665 - 375 WP_003413177.1 hypothetical protein -
JN986_RS13235 2865765..2866160 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
JN986_RS13240 2866157..2866402 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
JN986_RS13245 2866813..2867232 - 420 WP_003413190.1 A24 family peptidase -
JN986_RS13250 2867244..2868053 - 810 WP_003413193.1 shikimate dehydrogenase -
JN986_RS13255 2868050..2869324 - 1275 WP_202592800.1 endolytic transglycosylase MltG -
JN986_RS13260 2869317..2869829 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T289884 WP_003413174.1 NZ_LR882499:2864898-2865275 [Mycobacterium tuberculosis variant microti OV254]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT289884 WP_003413167.1 NZ_LR882499:2864644-2864901 [Mycobacterium tuberculosis variant microti OV254]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References