Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2850304..2850944 Replicon chromosome
Accession NZ_LR882499
Organism Mycobacterium tuberculosis variant microti OV254 isolate vole

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag JN986_RS13130 Protein ID WP_003412970.1
Coordinates 2850304..2850723 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag JN986_RS13135 Protein ID WP_003412975.1
Coordinates 2850720..2850944 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN986_RS13100 2845889..2846611 - 723 WP_003412957.1 DUF1906 domain-containing protein -
JN986_RS13105 2847128..2847355 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
JN986_RS13110 2847352..2847753 + 402 WP_003412963.1 PIN domain-containing protein -
JN986_RS13115 2847788..2848708 - 921 WP_003412965.1 restriction endonuclease -
JN986_RS13120 2849049..2849294 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JN986_RS13125 2849353..2850303 + 951 WP_003911916.1 Lsr2 family protein -
JN986_RS13130 2850304..2850723 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
JN986_RS13135 2850720..2850944 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
JN986_RS13140 2850975..2853819 - 2845 Protein_2593 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
JN986_RS13145 2853891..2854292 - 402 WP_003412981.1 hypothetical protein -
JN986_RS13150 2854292..2854762 - 471 WP_003412985.1 transcription antitermination factor NusB -
JN986_RS13155 2854765..2855328 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T289882 WP_003412970.1 NZ_LR882499:c2850723-2850304 [Mycobacterium tuberculosis variant microti OV254]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT289882 WP_003412975.1 NZ_LR882499:c2850944-2850720 [Mycobacterium tuberculosis variant microti OV254]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References