Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
| Location | 2326418..2327054 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P0CL62 |
| Locus tag | JN986_RS10685 | Protein ID | WP_003410654.1 |
| Coordinates | 2326644..2327054 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P9WJ84 |
| Locus tag | JN986_RS10680 | Protein ID | WP_003410651.1 |
| Coordinates | 2326418..2326651 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS10670 | 2322268..2322672 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
| JN986_RS10675 | 2322756..2326340 | - | 3585 | WP_105799686.1 | cobaltochelatase subunit CobN | - |
| JN986_RS10680 | 2326418..2326651 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
| JN986_RS10685 | 2326644..2327054 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
| JN986_RS10690 | 2327038..2328129 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
| JN986_RS10695 | 2328139..2328765 | + | 627 | WP_003410658.1 | precorrin-8X methylmutase | - |
| JN986_RS10700 | 2328762..2330288 | + | 1527 | Protein_2115 | precorrin-2 C(20)-methyltransferase | - |
| JN986_RS10705 | 2330234..2331457 | - | 1224 | WP_105799664.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T289878 WP_003410654.1 NZ_LR882499:2326644-2327054 [Mycobacterium tuberculosis variant microti OV254]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|