289872

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2215627..2216171 Replicon chromosome
Accession NZ_LR882499
Organism Mycobacterium tuberculosis variant microti OV254 isolate vole

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag JN986_RS10165 Protein ID WP_003409896.1
Coordinates 2215627..2215923 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag JN986_RS10170 Protein ID WP_003409899.1
Coordinates 2215920..2216171 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN986_RS10110 2210660..2211010 - 351 WP_003409871.1 hypothetical protein -
JN986_RS10115 2211021..2211923 - 903 WP_003409874.1 hypothetical protein -
JN986_RS10120 2211944..2212135 - 192 WP_003409876.1 hypothetical protein -
JN986_RS10125 2212136..2212432 - 297 WP_003409877.1 hypothetical protein -
JN986_RS10130 2212672..2212887 + 216 WP_003409878.1 antitoxin -
JN986_RS10135 2212884..2213195 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
JN986_RS10140 2213169..2213690 - 522 WP_003904745.1 hypothetical protein -
JN986_RS10145 2213665..2214042 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
JN986_RS10150 2214084..2214533 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
JN986_RS10155 2214530..2215075 + 546 WP_003409891.1 SecB-like chaperone -
JN986_RS10160 2214964..2215578 - 615 WP_003901296.1 hypothetical protein -
JN986_RS10165 2215627..2215923 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JN986_RS10170 2215920..2216171 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
JN986_RS10175 2216158..2216652 + 495 WP_003899099.1 hypothetical protein -
JN986_RS10180 2216812..2217219 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
JN986_RS10185 2217223..2217495 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
JN986_RS10190 2217528..2218748 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
JN986_RS10195 2219647..2219952 + 306 Protein_2014 ABC transporter permease -
JN986_RS10200 2220136..2220435 + 300 Protein_2015 SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T289872 WP_003409896.1 NZ_LR882499:c2215923-2215627 [Mycobacterium tuberculosis variant microti OV254]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT289872 WP_003409899.1 NZ_LR882499:c2216171-2215920 [Mycobacterium tuberculosis variant microti OV254]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References