Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2206590..2207293 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TLK7 |
| Locus tag | JN986_RS10075 | Protein ID | WP_003409778.1 |
| Coordinates | 2206590..2206919 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TLK8 |
| Locus tag | JN986_RS10080 | Protein ID | WP_003409780.1 |
| Coordinates | 2206916..2207293 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS10055 | 2202976..2204042 | + | 1067 | Protein_1986 | epoxide hydrolase EphB | - |
| JN986_RS10060 | 2204039..2204554 | + | 516 | WP_202592786.1 | flavin reductase family protein | - |
| JN986_RS10065 | 2204551..2205613 | + | 1063 | Protein_1988 | 3,4-dihydroxy-2-butanone-4-phosphate synthase | - |
| JN986_RS10070 | 2205610..2206380 | + | 771 | WP_003409775.1 | SDR family oxidoreductase | - |
| JN986_RS10075 | 2206590..2206919 | - | 330 | WP_003409778.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| JN986_RS10080 | 2206916..2207293 | - | 378 | WP_003409780.1 | type II toxin-antitoxin system antitoxin MazE5 | Antitoxin |
| JN986_RS10085 | 2207290..2207880 | - | 591 | WP_003409784.1 | SEC-C domain-containing protein | - |
| JN986_RS10090 | 2207935..2209299 | + | 1365 | WP_003903691.1 | HNH endonuclease | - |
| JN986_RS10095 | 2209454..2209906 | - | 453 | WP_003899095.1 | lipoprotein | - |
| JN986_RS10100 | 2209970..2210371 | + | 402 | WP_003409869.1 | hypothetical protein | - |
| JN986_RS10105 | 2210364..2210546 | - | 183 | WP_003409870.1 | hypothetical protein | - |
| JN986_RS10110 | 2210660..2211010 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| JN986_RS10115 | 2211021..2211923 | - | 903 | WP_003409874.1 | hypothetical protein | - |
| JN986_RS10120 | 2211944..2212135 | - | 192 | WP_003409876.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 11787.82 Da Isoelectric Point: 8.5361
>T289870 WP_003409778.1 NZ_LR882499:c2206919-2206590 [Mycobacterium tuberculosis variant microti OV254]
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
VTALPARGEVWWCEMAEIGRRPVVVLSRDAAIPRLRRALVAPCTTTIRGLASEVVLEPGSDPIPRRSAVNLDSVESVSVA
VLVNRLGRLADIRMRAICTALEVAVDCSR
Download Length: 330 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13560.07 Da Isoelectric Point: 5.1519
>AT289870 WP_003409780.1 NZ_LR882499:c2207293-2206916 [Mycobacterium tuberculosis variant microti OV254]
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
VKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDE
ALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|