Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1774525..1775138 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P64880 |
| Locus tag | JN986_RS08185 | Protein ID | WP_003407786.1 |
| Coordinates | 1774734..1775138 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A0E8UJ46 |
| Locus tag | JN986_RS08180 | Protein ID | WP_009935474.1 |
| Coordinates | 1774525..1774728 (+) | Length | 68 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS08165 | 1769789..1772692 | + | 2904 | WP_003407779.1 | MMPL family transporter | - |
| JN986_RS08170 | 1772702..1773148 | + | 447 | WP_003407780.1 | F420H(2)-dependent quinone reductase | - |
| JN986_RS08175 | 1773183..1774472 | + | 1290 | WP_003407781.1 | threonine ammonia-lyase | - |
| JN986_RS08180 | 1774525..1774728 | + | 204 | WP_009935474.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JN986_RS08185 | 1774734..1775138 | + | 405 | WP_003407786.1 | type II toxin-antitoxin system toxin ribonuclease VapC11 | Toxin |
| JN986_RS08190 | 1775155..1776897 | - | 1743 | WP_003407788.1 | malto-oligosyltrehalose trehalohydrolase | - |
| JN986_RS08195 | 1776890..1779187 | - | 2298 | WP_105799702.1 | malto-oligosyltrehalose synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14650.76 Da Isoelectric Point: 5.6587
>T289867 WP_003407786.1 NZ_LR882499:1774734-1775138 [Mycobacterium tuberculosis variant microti OV254]
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
MILIDTSAWVEYFRATGSIAAVEVRRLLSEEAARIAMCEPIAMEILSGALDDNTHTTLERLVNGLPSLNVDDAIDFRAAA
GIYRAARRAGETVRSINDCLIAALAIRHGARIVHRDADFDVIARITNLQAASFR
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|