Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 1241575..1242143 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TH08 |
| Locus tag | JN986_RS05845 | Protein ID | WP_003405865.1 |
| Coordinates | 1241769..1242143 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TH07 |
| Locus tag | JN986_RS05840 | Protein ID | WP_003405863.1 |
| Coordinates | 1241575..1241772 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS05820 | 1237616..1238254 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
| JN986_RS05825 | 1238344..1239351 | + | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
| JN986_RS05830 | 1239368..1240351 | - | 984 | WP_003898731.1 | hypothetical protein | - |
| JN986_RS05835 | 1240414..1241487 | + | 1074 | WP_105799741.1 | redox-regulated ATPase YchF | - |
| JN986_RS05840 | 1241575..1241772 | + | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JN986_RS05845 | 1241769..1242143 | + | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN986_RS05850 | 1242346..1243044 | + | 699 | WP_003898733.1 | hypothetical protein | - |
| JN986_RS05855 | 1243162..1243347 | + | 186 | WP_003901093.1 | hypothetical protein | - |
| JN986_RS05860 | 1243274..1243549 | - | 276 | WP_003405867.1 | hypothetical protein | - |
| JN986_RS05865 | 1243792..1244115 | + | 324 | WP_003405871.1 | antibiotic biosynthesis monooxygenase | - |
| JN986_RS05870 | 1244130..1244840 | - | 711 | WP_003911399.1 | hypothetical protein | - |
| JN986_RS05875 | 1244862..1245071 | + | 210 | WP_003911400.1 | hypothetical protein | - |
| JN986_RS05880 | 1245023..1245730 | - | 708 | Protein_1158 | adenylate/guanylate cyclase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T289861 WP_003405865.1 NZ_LR882499:1241769-1242143 [Mycobacterium tuberculosis variant microti OV254]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|