Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 712422..713047 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQA0 |
| Locus tag | JN986_RS03220 | Protein ID | WP_003403218.1 |
| Coordinates | 712646..713047 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ36 |
| Locus tag | JN986_RS03215 | Protein ID | WP_003403213.1 |
| Coordinates | 712422..712649 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS03190 | 707601..707822 | - | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
| JN986_RS03195 | 707964..708569 | + | 606 | WP_105799909.1 | hypothetical protein | - |
| JN986_RS03200 | 708588..711155 | - | 2568 | WP_003900188.1 | SEC-C domain-containing protein | - |
| JN986_RS03205 | 711239..711988 | + | 750 | WP_003898528.1 | hypothetical protein | - |
| JN986_RS03210 | 711985..712227 | + | 243 | WP_003403210.1 | hypothetical protein | - |
| JN986_RS03215 | 712422..712649 | + | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
| JN986_RS03220 | 712646..713047 | + | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
| JN986_RS03225 | 713176..713259 | + | 84 | Protein_639 | galactose-1-phosphate uridylyltransferase | - |
| JN986_RS03230 | 713278..714360 | + | 1083 | WP_031652152.1 | galactose-1-phosphate uridylyltransferase | - |
| JN986_RS03235 | 714357..715448 | + | 1092 | WP_003403225.1 | galactokinase | - |
| JN986_RS03240 | 715843..717000 | + | 1158 | WP_003903091.1 | hypothetical protein | - |
| JN986_RS03245 | 717011..717958 | + | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T289849 WP_003403218.1 NZ_LR882499:712646-713047 [Mycobacterium tuberculosis variant microti OV254]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQA0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSC9 |