289847

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/AbrB(antitoxin)
Location 698794..699440 Replicon chromosome
Accession NZ_LR882499
Organism Mycobacterium tuberculosis variant microti OV254 isolate vole

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ88
Locus tag JN986_RS03115 Protein ID WP_003403137.1
Coordinates 698794..699207 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ89
Locus tag JN986_RS03120 Protein ID WP_003403139.1
Coordinates 699204..699440 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN986_RS03095 694877..696427 + 1551 WP_003403119.1 MCE family protein -
JN986_RS03100 696479..696871 - 393 WP_003403122.1 type II toxin-antitoxin system toxin ribonuclease C4 -
JN986_RS03105 696868..697125 - 258 WP_003403125.1 type II toxin-antitoxin system antitoxin VapB4 -
JN986_RS03110 697308..698543 - 1236 WP_003403128.1 ATP-binding protein -
JN986_RS03115 698794..699207 - 414 WP_003403137.1 type II toxin-antitoxin system VapC family toxin Toxin
JN986_RS03120 699204..699440 - 237 WP_003403139.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
JN986_RS03125 699544..700050 - 507 WP_003900973.1 two component system sensor kinase HK1 -
JN986_RS03130 700164..700694 - 531 WP_003917320.1 two component system sensor kinase HK2 -
JN986_RS03135 700678..701373 - 696 WP_003918099.1 two-component system response regulator TcrA -
JN986_RS03140 701496..701807 + 312 WP_003403164.1 hypothetical protein -
JN986_RS03145 701879..702829 + 951 WP_003907436.1 DUF1259 domain-containing protein -
JN986_RS03150 703070..703654 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
JN986_RS03155 703656..704369 + 714 Protein_625 IS607 family element transposase accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-126)

Antitoxin

SpoVT-AbrB domain

(3-43)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14786.14 Da        Isoelectric Point: 8.1405

>T289847 WP_003403137.1 NZ_LR882499:c699207-698794 [Mycobacterium tuberculosis variant microti OV254]
VKPPLAVDTSVAIPLLVRTHTAHAAVVAWWAHREAALCGHALAETYSVLTRLPRDLRLAPMDAARLLTERFAAPLLLSSR
TTEHLPRVLAQFEITGGAVYDALVALAAAEHRAELATRDARAKDTYEKIGVHVVVAA

Download         Length: 414 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 8212.41 Da        Isoelectric Point: 5.0351

>AT289847 WP_003403139.1 NZ_LR882499:c699440-699204 [Mycobacterium tuberculosis variant microti OV254]
MKAVVDAAGRIVVPKPLREALGLQPGSTVEISRYGAGLHLIPTGRTARLEEENGVLVATGETTIDDEVVFGLIDSGRK

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ88

Antitoxin

Source ID Structure
AlphaFold DB G0TQ89

References