Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 365077..365720 | Replicon | chromosome |
| Accession | NZ_LR882499 | ||
| Organism | Mycobacterium tuberculosis variant microti OV254 isolate vole | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WFB8 |
| Locus tag | JN986_RS01595 | Protein ID | WP_003401566.1 |
| Coordinates | 365295..365720 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | O07227 |
| Locus tag | JN986_RS01590 | Protein ID | WP_003401563.1 |
| Coordinates | 365077..365298 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN986_RS01565 | 360148..360951 | - | 804 | WP_003401540.1 | hypothetical protein | - |
| JN986_RS01570 | 360961..362358 | - | 1398 | WP_003401544.1 | sulfatase | - |
| JN986_RS01575 | 362537..364360 | + | 1824 | WP_105826467.1 | PE family protein | - |
| JN986_RS01580 | 364503..364730 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | - |
| JN986_RS01585 | 364727..365029 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | - |
| JN986_RS01590 | 365077..365298 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | Antitoxin |
| JN986_RS01595 | 365295..365720 | + | 426 | WP_003401566.1 | PIN domain nuclease | Toxin |
| JN986_RS01600 | 365856..366488 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
| JN986_RS01605 | 366485..367393 | + | 909 | WP_003900117.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15713.90 Da Isoelectric Point: 5.6002
>T289843 WP_003401566.1 NZ_LR882499:365295-365720 [Mycobacterium tuberculosis variant microti OV254]
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
VTDQRWLIDKSALVRLTDSPDMEIWSNRIERGLVHITGVTRLEVGFSAECGEIARREFREPPLSAMPVEYLTPRIEDRAL
EVQTLLADRGHHRGPSIPDLLIAATAELSGLTVLHVDKDFDAIAALTGQKTERLTHRPPSA
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3H87 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3H87 | |
| AlphaFold DB | A0A829CG48 |