Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/Txe-YefM |
| Location | 3760598..3761127 | Replicon | chromosome |
| Accession | NZ_LR882498 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TI95 |
| Locus tag | JN980_RS17475 | Protein ID | WP_003417760.1 |
| Coordinates | 3760870..3761127 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | G0TI94 |
| Locus tag | JN980_RS17470 | Protein ID | WP_003417757.1 |
| Coordinates | 3760598..3760873 (+) | Length | 92 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN980_RS17450 | 3757396..3758833 | - | 1438 | Protein_3444 | FAD-binding oxidoreductase | - |
| JN980_RS17455 | 3758936..3759325 | + | 390 | WP_003417745.1 | DUF732 domain-containing protein | - |
| JN980_RS17460 | 3759339..3759632 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
| JN980_RS17465 | 3759629..3760474 | - | 846 | WP_003417751.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
| JN980_RS17470 | 3760598..3760873 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
| JN980_RS17475 | 3760870..3761127 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
| JN980_RS17480 | 3761169..3762359 | + | 1191 | WP_202582083.1 | NADH:flavin oxidoreductase | - |
| JN980_RS17485 | 3762476..3762844 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
| JN980_RS17490 | 3762841..3763392 | - | 552 | WP_105799777.1 | pentapeptide repeat protein MfpA | - |
| JN980_RS17495 | 3763399..3763980 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
| JN980_RS17500 | 3763961..3764329 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
| JN980_RS17505 | 3764307..3764699 | - | 393 | WP_003417776.1 | roadblock/LC7 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T289837 WP_003417760.1 NZ_LR882498:3760870-3761127 [Mycobacterium tuberculosis variant microti]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|