Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3709945..3710619 | Replicon | chromosome |
Accession | NZ_LR882498 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | JN980_RS17305 | Protein ID | WP_105799814.1 |
Coordinates | 3709945..3710373 (-) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | JN980_RS17310 | Protein ID | WP_003417286.1 |
Coordinates | 3710377..3710619 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN980_RS17280 | 3705767..3706168 | - | 402 | WP_003417264.1 | cytidine deaminase | - |
JN980_RS17285 | 3706309..3706743 | + | 435 | WP_003900017.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
JN980_RS17290 | 3706740..3707174 | + | 435 | WP_003417269.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
JN980_RS17295 | 3707303..3709075 | + | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
JN980_RS17300 | 3709075..3709866 | + | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
JN980_RS17305 | 3709945..3710373 | - | 429 | WP_105799814.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN980_RS17310 | 3710377..3710619 | - | 243 | WP_003417286.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
JN980_RS17315 | 3710741..3711355 | - | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
JN980_RS17320 | 3711352..3712017 | - | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
JN980_RS17325 | 3712018..3712551 | - | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
JN980_RS17330 | 3712548..3712922 | - | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
JN980_RS17335 | 3713019..3714083 | - | 1065 | WP_003913037.1 | GTP 3',8-cyclase MoaA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15751.08 Da Isoelectric Point: 8.3191
>T289836 WP_105799814.1 NZ_LR882498:c3710373-3709945 [Mycobacterium tuberculosis variant microti]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGCASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGCASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|