Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3111572..3112142 | Replicon | chromosome |
Accession | NZ_LR882498 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P71650 |
Locus tag | JN980_RS14570 | Protein ID | WP_003414166.1 |
Coordinates | 3111572..3111928 (-) | Length | 119 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P0CL61 |
Locus tag | JN980_RS14575 | Protein ID | WP_003901465.1 |
Coordinates | 3111912..3112142 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN980_RS14550 | 3107024..3108712 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
JN980_RS14555 | 3108716..3109042 | - | 327 | WP_003414157.1 | hypothetical protein | - |
JN980_RS14560 | 3109215..3109802 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
JN980_RS14565 | 3109821..3111470 | + | 1650 | WP_105799646.1 | CocE/NonD family hydrolase | - |
JN980_RS14570 | 3111572..3111928 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
JN980_RS14575 | 3111912..3112142 | - | 231 | WP_003901465.1 | antitoxin MazE | Antitoxin |
JN980_RS14580 | 3112185..3113228 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
JN980_RS14585 | 3113419..3113694 | + | 276 | WP_003911993.1 | DUF1778 domain-containing protein | - |
JN980_RS14590 | 3113870..3114124 | - | 255 | WP_003917684.1 | hypothetical protein | - |
JN980_RS14595 | 3114272..3114676 | + | 405 | WP_003414181.1 | hypothetical protein | - |
JN980_RS14600 | 3114673..3114864 | + | 192 | WP_003414184.1 | hypothetical protein | - |
JN980_RS14605 | 3114928..3116217 | + | 1290 | Protein_2880 | transposase family protein | - |
JN980_RS14610 | 3116451..3116708 | + | 258 | WP_003899489.1 | hypothetical protein | - |
JN980_RS14615 | 3116813..3117124 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T289830 WP_003414166.1 NZ_LR882498:c3111928-3111572 [Mycobacterium tuberculosis variant microti]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|