Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3071587..3072266 | Replicon | chromosome |
| Accession | NZ_LR882498 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF90 |
| Locus tag | JN980_RS14350 | Protein ID | WP_003414059.1 |
| Coordinates | 3071587..3072003 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TF64 |
| Locus tag | JN980_RS14355 | Protein ID | WP_003414061.1 |
| Coordinates | 3072000..3072266 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN980_RS14330 | 3067639..3068541 | - | 903 | WP_003900564.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| JN980_RS14335 | 3068610..3069362 | - | 753 | WP_003899465.1 | FAD-dependent thymidylate synthase | - |
| JN980_RS14340 | 3069606..3069881 | - | 276 | WP_003414055.1 | type I restriction endonuclease subunit S | - |
| JN980_RS14345 | 3069878..3071500 | - | 1623 | WP_003414057.1 | type I restriction-modification system subunit M | - |
| JN980_RS14350 | 3071587..3072003 | - | 417 | WP_003414059.1 | type II toxin-antitoxin system toxin ribonuclease C21 | Toxin |
| JN980_RS14355 | 3072000..3072266 | - | 267 | WP_003414061.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JN980_RS14360 | 3072292..3072687 | - | 396 | WP_202582055.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN980_RS14365 | 3072684..3072953 | - | 270 | WP_003414066.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| JN980_RS14370 | 3072963..3074057 | - | 1095 | WP_003414068.1 | restriction endonuclease subunit S | - |
| JN980_RS14375 | 3074054..3074473 | - | 420 | WP_003414070.1 | winged helix-turn-helix domain-containing protein | - |
| JN980_RS14380 | 3074547..3075026 | - | 480 | WP_003414073.1 | dihydrofolate reductase | - |
| JN980_RS14385 | 3075097..3075897 | - | 801 | WP_003911953.1 | thymidylate synthase | - |
| JN980_RS14390 | 3076053..3076790 | + | 738 | WP_003414079.1 | dienelactone hydrolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15773.00 Da Isoelectric Point: 7.1294
>T289828 WP_003414059.1 NZ_LR882498:c3072003-3071587 [Mycobacterium tuberculosis variant microti]
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYRRDALEYVNTPDTVWVRAWEI
QEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFERIAAITRQPVEWVVAPGTA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|