Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2871152..2871789 | Replicon | chromosome |
Accession | NZ_LR882498 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0DMV7 |
Locus tag | JN980_RS13260 | Protein ID | WP_003413180.1 |
Coordinates | 2871152..2871547 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ44 |
Locus tag | JN980_RS13265 | Protein ID | WP_003413183.1 |
Coordinates | 2871544..2871789 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN980_RS13220 | 2866555..2867766 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
JN980_RS13225 | 2867893..2868552 | + | 660 | WP_031719937.1 | LppA family lipoprotein | - |
JN980_RS13230 | 2868549..2869211 | + | 663 | WP_052624433.1 | hypothetical protein | - |
JN980_RS13235 | 2869208..2869486 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
JN980_RS13240 | 2869579..2869992 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
JN980_RS13245 | 2870031..2870288 | + | 258 | WP_003413167.1 | ribbon-helix-helix domain-containing protein | - |
JN980_RS13250 | 2870285..2870662 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
JN980_RS13255 | 2870678..2871052 | - | 375 | WP_003413177.1 | hypothetical protein | - |
JN980_RS13260 | 2871152..2871547 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | Toxin |
JN980_RS13265 | 2871544..2871789 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | Antitoxin |
JN980_RS13270 | 2872200..2872619 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
JN980_RS13275 | 2872631..2873440 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
JN980_RS13280 | 2873437..2874705 | - | 1269 | WP_202582048.1 | endolytic transglycosylase MltG | - |
JN980_RS13285 | 2874698..2875210 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14619.53 Da Isoelectric Point: 6.9794
>T289825 WP_003413180.1 NZ_LR882498:c2871547-2871152 [Mycobacterium tuberculosis variant microti]
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
MIFVDTSFWAALGNAGDARHGTAKRLWASKPPVVMTSNHVLGETWTLLNRRCGHRAAVAAAAIRLSTVVRVEHVTADLEE
QAWEWLVRHDEREYSFVDATSFAVMRKKGIQNAYAFDGDFSAAGFVEVRPE
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5WZ4 | |
PDB | 5WZF |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW31 |