Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 2869579..2870288 | Replicon | chromosome |
| Accession | NZ_LR882498 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQ26 |
| Locus tag | JN980_RS13240 | Protein ID | WP_003413164.1 |
| Coordinates | 2869579..2869992 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P95006 |
| Locus tag | JN980_RS13245 | Protein ID | WP_003413167.1 |
| Coordinates | 2870031..2870288 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN980_RS13210 | 2864632..2865837 | - | 1206 | WP_003413027.1 | chorismate synthase | - |
| JN980_RS13215 | 2865945..2866259 | + | 315 | WP_009937839.1 | hypothetical protein | - |
| JN980_RS13220 | 2866555..2867766 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
| JN980_RS13225 | 2867893..2868552 | + | 660 | WP_031719937.1 | LppA family lipoprotein | - |
| JN980_RS13230 | 2868549..2869211 | + | 663 | WP_052624433.1 | hypothetical protein | - |
| JN980_RS13235 | 2869208..2869486 | + | 279 | WP_003901422.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| JN980_RS13240 | 2869579..2869992 | + | 414 | WP_003413164.1 | PIN domain nuclease | Toxin |
| JN980_RS13245 | 2870031..2870288 | + | 258 | WP_003413167.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JN980_RS13250 | 2870285..2870662 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN980_RS13255 | 2870678..2871052 | - | 375 | WP_003413177.1 | hypothetical protein | - |
| JN980_RS13260 | 2871152..2871547 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
| JN980_RS13265 | 2871544..2871789 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
| JN980_RS13270 | 2872200..2872619 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
| JN980_RS13275 | 2872631..2873440 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
| JN980_RS13280 | 2873437..2874705 | - | 1269 | WP_202582048.1 | endolytic transglycosylase MltG | - |
| JN980_RS13285 | 2874698..2875210 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15045.00 Da Isoelectric Point: 5.4673
>T289823 WP_003413164.1 NZ_LR882498:2869579-2869992 [Mycobacterium tuberculosis variant microti]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQ26 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C9W5 |