289823

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 2869579..2870288 Replicon chromosome
Accession NZ_LR882498
Organism Mycobacterium tuberculosis variant microti strain Maus III isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ26
Locus tag JN980_RS13240 Protein ID WP_003413164.1
Coordinates 2869579..2869992 (+) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag JN980_RS13245 Protein ID WP_003413167.1
Coordinates 2870031..2870288 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN980_RS13210 2864632..2865837 - 1206 WP_003413027.1 chorismate synthase -
JN980_RS13215 2865945..2866259 + 315 WP_009937839.1 hypothetical protein -
JN980_RS13220 2866555..2867766 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
JN980_RS13225 2867893..2868552 + 660 WP_031719937.1 LppA family lipoprotein -
JN980_RS13230 2868549..2869211 + 663 WP_052624433.1 hypothetical protein -
JN980_RS13235 2869208..2869486 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
JN980_RS13240 2869579..2869992 + 414 WP_003413164.1 PIN domain nuclease Toxin
JN980_RS13245 2870031..2870288 + 258 WP_003413167.1 ribbon-helix-helix domain-containing protein Antitoxin
JN980_RS13250 2870285..2870662 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin -
JN980_RS13255 2870678..2871052 - 375 WP_003413177.1 hypothetical protein -
JN980_RS13260 2871152..2871547 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
JN980_RS13265 2871544..2871789 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
JN980_RS13270 2872200..2872619 - 420 WP_003413190.1 A24 family peptidase -
JN980_RS13275 2872631..2873440 - 810 WP_003413193.1 shikimate dehydrogenase -
JN980_RS13280 2873437..2874705 - 1269 WP_202582048.1 endolytic transglycosylase MltG -
JN980_RS13285 2874698..2875210 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-122)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15045.00 Da        Isoelectric Point: 5.4673

>T289823 WP_003413164.1 NZ_LR882498:2869579-2869992 [Mycobacterium tuberculosis variant microti]
MVFCVDTSAWHHAARPEVARRWLAALSADQIGICDHVRLEILYSANSATDYDALADELDGLARIPVGAETFTRACQVQRE
LAHVAGLHHRSVKIADLVIAAAAELSGTIVWHYDENYDRVAAITGQPTEWIVPRGTL

Download         Length: 414 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT289823 WP_003413167.1 NZ_LR882498:2870031-2870288 [Mycobacterium tuberculosis variant microti]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ26

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References