Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2855691..2856331 | Replicon | chromosome |
Accession | NZ_LR882498 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ08 |
Locus tag | JN980_RS13155 | Protein ID | WP_003412970.1 |
Coordinates | 2855691..2856110 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ09 |
Locus tag | JN980_RS13160 | Protein ID | WP_003412975.1 |
Coordinates | 2856107..2856331 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN980_RS13125 | 2851276..2851998 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
JN980_RS13130 | 2852515..2852742 | + | 228 | WP_003412960.1 | type II toxin-antitoxin system VapB family antitoxin | - |
JN980_RS13135 | 2852739..2853140 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
JN980_RS13140 | 2853175..2854095 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
JN980_RS13145 | 2854436..2854681 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
JN980_RS13150 | 2854740..2855690 | + | 951 | WP_003911916.1 | Lsr2 family protein | - |
JN980_RS13155 | 2855691..2856110 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN980_RS13160 | 2856107..2856331 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
JN980_RS13165 | 2856362..2859206 | - | 2845 | Protein_2596 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
JN980_RS13170 | 2859278..2859679 | - | 402 | WP_003412981.1 | hypothetical protein | - |
JN980_RS13175 | 2859679..2860149 | - | 471 | WP_003412985.1 | transcription antitermination factor NusB | - |
JN980_RS13180 | 2860152..2860715 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T289822 WP_003412970.1 NZ_LR882498:c2856110-2855691 [Mycobacterium tuberculosis variant microti]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|