Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2809514..2810166 | Replicon | chromosome |
Accession | NZ_LR882498 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TPX1 |
Locus tag | JN980_RS12960 | Protein ID | WP_003412752.1 |
Coordinates | 2809741..2810166 (+) | Length | 142 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ24 |
Locus tag | JN980_RS12955 | Protein ID | WP_003412749.1 |
Coordinates | 2809514..2809735 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN980_RS12940 | 2807754..2807960 | - | 207 | WP_003899347.1 | hypothetical protein | - |
JN980_RS12945 | 2808096..2808719 | + | 624 | WP_202582046.1 | TIGR00725 family protein | - |
JN980_RS12950 | 2808709..2809461 | + | 753 | WP_105799954.1 | hypothetical protein | - |
JN980_RS12955 | 2809514..2809735 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
JN980_RS12960 | 2809741..2810166 | + | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
JN980_RS12965 | 2810189..2811370 | - | 1182 | WP_003899351.1 | 2-oxo acid dehydrogenase subunit E2 | - |
JN980_RS12970 | 2811367..2812413 | - | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
JN980_RS12975 | 2812424..2813527 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
JN980_RS12980 | 2813786..2814607 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
JN980_RS12985 | 2814604..2815161 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T289821 WP_003412752.1 NZ_LR882498:2809741-2810166 [Mycobacterium tuberculosis variant microti]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TPX1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BW03 |