Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 1969817..1970277 | Replicon | chromosome |
| Accession | NZ_LR882498 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A7U4FB26 |
| Locus tag | JN980_RS09050 | Protein ID | WP_003408531.1 |
| Coordinates | 1970029..1970277 (+) | Length | 83 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ30 |
| Locus tag | JN980_RS09045 | Protein ID | WP_003408528.1 |
| Coordinates | 1969817..1970029 (+) | Length | 71 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN980_RS09030 | 1966295..1967482 | - | 1188 | WP_003898992.1 | nitrate transporter NarK | - |
| JN980_RS09035 | 1967769..1968053 | + | 285 | WP_003408522.1 | DUF1876 domain-containing protein | - |
| JN980_RS09040 | 1968067..1969749 | - | 1683 | WP_003898994.1 | SulP family inorganic anion transporter | - |
| JN980_RS09045 | 1969817..1970029 | + | 213 | WP_003408528.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JN980_RS09050 | 1970029..1970277 | + | 249 | WP_003408531.1 | hypothetical protein | Toxin |
| JN980_RS09055 | 1970285..1971023 | + | 739 | Protein_1785 | hypothetical protein | - |
| JN980_RS09060 | 1971117..1972817 | + | 1701 | WP_003898998.1 | serine/threonine protein kinase PknE | - |
| JN980_RS09065 | 1973102..1973503 | - | 402 | WP_003408538.1 | hypothetical protein | - |
| JN980_RS09070 | 1973493..1974104 | - | 612 | WP_003898999.1 | isopentenyl-diphosphate Delta-isomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 83 a.a. Molecular weight: 8857.07 Da Isoelectric Point: 3.9794
>T289809 WP_003408531.1 NZ_LR882498:1970029-1970277 [Mycobacterium tuberculosis variant microti]
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYTGDDFACIDIRAVL
AG
Download Length: 249 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FB26 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CFE8 |