Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1695261..1695877 | Replicon | chromosome |
| Accession | NZ_LR882498 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G0TJ74 |
| Locus tag | JN980_RS07850 | Protein ID | WP_003407593.1 |
| Coordinates | 1695560..1695877 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TJ73 |
| Locus tag | JN980_RS07845 | Protein ID | WP_003900349.1 |
| Coordinates | 1695261..1695563 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN980_RS07835 | 1691147..1692994 | + | 1848 | WP_202582012.1 | methylmalonyl-CoA mutase small subunit | - |
| JN980_RS07840 | 1692995..1695247 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
| JN980_RS07845 | 1695261..1695563 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
| JN980_RS07850 | 1695560..1695877 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
| JN980_RS07855 | 1695874..1696878 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
| JN980_RS07860 | 1696931..1698220 | + | 1290 | WP_003407599.1 | serine hydrolase | - |
| JN980_RS07865 | 1698293..1699066 | - | 774 | WP_003912632.1 | class I SAM-dependent methyltransferase | - |
| JN980_RS07870 | 1699124..1699315 | - | 192 | WP_003407609.1 | dodecin family protein | - |
| JN980_RS07875 | 1699346..1699570 | - | 225 | WP_160522526.1 | NUDIX domain-containing protein | - |
| JN980_RS07880 | 1699840..1700868 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T289806 WP_003407593.1 NZ_LR882498:1695560-1695877 [Mycobacterium tuberculosis variant microti]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11173.42 Da Isoelectric Point: 9.5564
>AT289806 WP_003900349.1 NZ_LR882498:1695261-1695563 [Mycobacterium tuberculosis variant microti]
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|