Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1234274..1234905 | Replicon | chromosome |
Accession | NZ_LR882498 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
Locus tag | JN980_RS05795 | Protein ID | WP_003405820.1 |
Coordinates | 1234274..1234585 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TGZ7 |
Locus tag | JN980_RS05800 | Protein ID | WP_003405836.1 |
Coordinates | 1234585..1234905 (-) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN980_RS05775 | 1229756..1231180 | - | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
JN980_RS05780 | 1231211..1232299 | - | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
JN980_RS05785 | 1232355..1232999 | + | 645 | WP_202581996.1 | DUF4245 domain-containing protein | - |
JN980_RS05790 | 1233006..1234162 | - | 1157 | Protein_1141 | AI-2E family transporter | - |
JN980_RS05795 | 1234274..1234585 | - | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
JN980_RS05800 | 1234585..1234905 | - | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
JN980_RS05805 | 1234915..1236440 | + | 1526 | Protein_1144 | carboxylesterase/lipase family protein | - |
JN980_RS05810 | 1236458..1237570 | - | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
JN980_RS05815 | 1237580..1237837 | - | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
JN980_RS05820 | 1237827..1239074 | - | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
JN980_RS05825 | 1239071..1239709 | - | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T289800 WP_003405820.1 NZ_LR882498:c1234585-1234274 [Mycobacterium tuberculosis variant microti]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Download Length: 107 a.a. Molecular weight: 11394.83 Da Isoelectric Point: 5.1236
>AT289800 WP_003405836.1 NZ_LR882498:c1234905-1234585 [Mycobacterium tuberculosis variant microti]
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEI
LATNTSATGDLDTLAGHCARTALDID
MYLPWGVVLAGGANGFGAGAYQTGTICEVSTQIAVRLPDEIVAFIDDEVRGQHARSRAAVVLRALERERRRRLAERDAEI
LATNTSATGDLDTLAGHCARTALDID
Download Length: 321 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4F9D0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TGZ7 |