Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 756701..757241 | Replicon | chromosome |
| Accession | NZ_LR882498 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P9WII0 |
| Locus tag | JN980_RS03450 | Protein ID | WP_003403376.1 |
| Coordinates | 756701..757009 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TQE0 |
| Locus tag | JN980_RS03455 | Protein ID | WP_003403381.1 |
| Coordinates | 756996..757241 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN980_RS03425 | 752016..753521 | + | 1506 | WP_003403360.1 | carotenoid cleavage oxygenase | - |
| JN980_RS03430 | 753602..754612 | + | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
| JN980_RS03435 | 755000..755383 | - | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
| JN980_RS03440 | 755478..755633 | - | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| JN980_RS03445 | 755709..756425 | - | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
| JN980_RS03450 | 756701..757009 | - | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| JN980_RS03455 | 756996..757241 | - | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| JN980_RS03460 | 757351..757788 | - | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN980_RS03465 | 757785..758039 | - | 255 | WP_003911263.1 | antitoxin VapB7 | - |
| JN980_RS03470 | 758153..760516 | + | 2364 | WP_003403397.1 | arylsulfatase AtsD | - |
| JN980_RS03475 | 760579..760905 | + | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| JN980_RS03480 | 760817..761155 | + | 339 | WP_003403405.1 | PIN domain-containing protein | - |
| JN980_RS03485 | 761152..761325 | + | 174 | WP_003898549.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11320.10 Da Isoelectric Point: 11.6554
>T289793 WP_003403376.1 NZ_LR882498:c757009-756701 [Mycobacterium tuberculosis variant microti]
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
MRRGELWFAATPGGDRPVLVLTRDPVADRIGAVVVVALTRTRRGLVSELELTAVENRVPSDCVVNFDNIHTLPRTAFRRR
ITRLSPARLHEACQTLRASTGC
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BSE5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQE0 |