Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC(toxin)
Location 704717..705360 Replicon chromosome
Accession NZ_LR882498
Organism Mycobacterium tuberculosis variant microti strain Maus III isolate human

Toxin (Protein)


Gene name vapC Uniprot ID P67239
Locus tag JN980_RS03165 Protein ID WP_003403187.1
Coordinates 704959..705360 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ91
Locus tag JN980_RS03160 Protein ID WP_003403184.1
Coordinates 704717..704962 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN980_RS03125 699997..700527 - 531 WP_003917320.1 two component system sensor kinase HK2 -
JN980_RS03130 700511..701206 - 696 WP_003918099.1 two-component system response regulator TcrA -
JN980_RS03135 701329..701640 + 312 WP_003403164.1 hypothetical protein -
JN980_RS03140 701712..702662 + 951 WP_003907436.1 DUF1259 domain-containing protein -
JN980_RS03145 702903..703487 + 585 WP_003403171.1 IS607-like element IS1536 family transposase -
JN980_RS03150 703489..704202 + 714 Protein_625 IS607 family element transposase accessory protein TnpB -
JN980_RS03155 704202..704672 + 471 WP_003898523.1 hypothetical protein -
JN980_RS03160 704717..704962 + 246 WP_003403184.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
JN980_RS03165 704959..705360 + 402 WP_003403187.1 type II toxin-antitoxin system VapC family toxin Toxin
JN980_RS03170 705748..705915 - 168 WP_077385191.1 DUF3800 domain-containing protein -
JN980_RS03175 705948..706145 - 198 WP_003403191.1 hypothetical protein -
JN980_RS03180 706225..707382 - 1158 WP_003403193.1 hypothetical protein -
JN980_RS03185 707434..707655 - 222 WP_003898525.1 DUF4926 domain-containing protein -
JN980_RS03190 707797..708402 + 606 WP_105799909.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-124)

Antitoxin

Antitoxin VapB-like

(1-80)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14501.21 Da        Isoelectric Point: 4.4463

>T289788 WP_003403187.1 NZ_LR882498:704959-705360 [Mycobacterium tuberculosis variant microti]
VIVDTSAIIAILRDEDDAAAYADALANADVRRLSAASYLECGIVLDSQRDPVISRALDELIEEAEFVVEPVTERQARLAR
AAYADFGRGSGHPAGLNFGDCLSYALAIDRREPLLWKGNDFGHTGVQRALDRR

Download         Length: 402 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8813.12 Da        Isoelectric Point: 10.3486

>AT289788 WP_003403184.1 NZ_LR882498:704717-704962 [Mycobacterium tuberculosis variant microti]
MALNIKDPSVHQAVKQIAKITGESQARAVATAVNERLARLRSDDLAARLLAIGHKTASRMSPEAKRLDHDALLYDERGLP
A

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BSD6

Antitoxin

Source ID Structure
AlphaFold DB G0TQ91

References