Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Rv0298-Rv0299/- |
Location | 364484..365010 | Replicon | chromosome |
Accession | NZ_LR882498 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus III isolate human |
Toxin (Protein)
Gene name | Rv0299 | Uniprot ID | - |
Locus tag | JN980_RS01580 | Protein ID | WP_003401560.1 |
Coordinates | 364708..365010 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | Rv0298 | Uniprot ID | P9WJ08 |
Locus tag | JN980_RS01575 | Protein ID | WP_003401555.1 |
Coordinates | 364484..364711 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN980_RS01560 | 360129..360932 | - | 804 | WP_003401540.1 | hypothetical protein | - |
JN980_RS01565 | 360942..362339 | - | 1398 | WP_003401544.1 | sulfatase | - |
JN980_RS01570 | 362518..364341 | + | 1824 | WP_105826467.1 | PE family protein | - |
JN980_RS01575 | 364484..364711 | + | 228 | WP_003401555.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
JN980_RS01580 | 364708..365010 | + | 303 | WP_003401560.1 | toxin-antitoxin system toxin | Toxin |
JN980_RS01585 | 365058..365279 | + | 222 | WP_003401563.1 | type II toxin-antitoxin system antitoxin VapB2 | - |
JN980_RS01590 | 365276..365701 | + | 426 | WP_003401566.1 | PIN domain nuclease | - |
JN980_RS01595 | 365837..366469 | + | 633 | WP_003401571.1 | TetR/AcrR family transcriptional regulator | - |
JN980_RS01600 | 366466..367374 | + | 909 | WP_003900117.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10442.16 Da Isoelectric Point: 4.9609
>T289781 WP_003401560.1 NZ_LR882498:364708-365010 [Mycobacterium tuberculosis variant microti]
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
MIAPGDIAPRRDSEHELYVAVLSNALHRAADTGRVITCPFIPGRVPEDLLAMVVAVEQPNGTLLPELVQWLHVAALGAPL
GNAGVAALREAASVVTALLC
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|