Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Txe-YefM |
Location | 3763103..3763632 | Replicon | chromosome |
Accession | NZ_LR882497 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TI95 |
Locus tag | JN995_RS17505 | Protein ID | WP_003417760.1 |
Coordinates | 3763375..3763632 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G0TI94 |
Locus tag | JN995_RS17500 | Protein ID | WP_003417757.1 |
Coordinates | 3763103..3763378 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN995_RS17480 | 3759901..3761338 | - | 1438 | Protein_3451 | FAD-binding oxidoreductase | - |
JN995_RS17485 | 3761441..3761830 | + | 390 | WP_003417745.1 | DUF732 domain-containing protein | - |
JN995_RS17490 | 3761844..3762137 | - | 294 | WP_003417749.1 | DUF3017 domain-containing protein | - |
JN995_RS17495 | 3762134..3762979 | - | 846 | WP_003417751.1 | bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | - |
JN995_RS17500 | 3763103..3763378 | + | 276 | WP_003417757.1 | type II toxin-antitoxin system antitoxin RelJ | Antitoxin |
JN995_RS17505 | 3763375..3763632 | + | 258 | WP_003417760.1 | Txe/YoeB family addiction module toxin | Toxin |
JN995_RS17510 | 3763674..3764864 | + | 1191 | WP_202582083.1 | NADH:flavin oxidoreductase | - |
JN995_RS17515 | 3764981..3765349 | + | 369 | WP_003417765.1 | FHA domain-containing protein | - |
JN995_RS17520 | 3765346..3765897 | - | 552 | WP_105799777.1 | pentapeptide repeat protein MfpA | - |
JN995_RS17525 | 3765904..3766485 | - | 582 | WP_003417769.1 | ATP/GTP-binding protein | - |
JN995_RS17530 | 3766466..3766834 | - | 369 | WP_003417772.1 | DUF742 domain-containing protein | - |
JN995_RS17535 | 3766812..3767204 | - | 393 | WP_003417776.1 | roadblock/LC7 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 10070.30 Da Isoelectric Point: 6.4693
>T289777 WP_003417760.1 NZ_LR882497:3763375-3763632 [Mycobacterium tuberculosis variant microti]
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
VRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRRIDDEHRLVYRAGDDEVTMLK
ARYHY
Download Length: 258 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|