Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 3177428..3177976 | Replicon | chromosome |
Accession | NZ_LR882497 | ||
Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human |
Toxin (Protein)
Gene name | relE | Uniprot ID | G0TFG5 |
Locus tag | JN995_RS14940 | Protein ID | WP_003414602.1 |
Coordinates | 3177713..3177976 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | O33347 |
Locus tag | JN995_RS14935 | Protein ID | WP_003414599.1 |
Coordinates | 3177428..3177709 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JN995_RS14910 | 3173051..3173908 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
JN995_RS14915 | 3173950..3174534 | - | 585 | WP_003414585.1 | DUF1707 domain-containing protein | - |
JN995_RS14920 | 3174638..3174886 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
JN995_RS14925 | 3174883..3175263 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
JN995_RS14930 | 3175345..3177156 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
JN995_RS14935 | 3177428..3177709 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
JN995_RS14940 | 3177713..3177976 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
JN995_RS14945 | 3178349..3179203 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
JN995_RS14950 | 3179259..3180422 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
JN995_RS14955 | 3180439..3181653 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
JN995_RS14960 | 3181661..3182902 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T289773 WP_003414602.1 NZ_LR882497:3177713-3177976 [Mycobacterium tuberculosis variant microti]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|