Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2934047..2934761 Replicon chromosome
Accession NZ_LR882497
Organism Mycobacterium tuberculosis variant microti strain Maus IV isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQK0
Locus tag JN995_RS13555 Protein ID WP_003413460.1
Coordinates 2934321..2934761 (+) Length 147 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ20
Locus tag JN995_RS13550 Protein ID WP_003413456.1
Coordinates 2934047..2934334 (+) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN995_RS13515 2929469..2929714 + 246 WP_003413429.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JN995_RS13520 2929711..2930115 + 405 WP_003413432.1 type II toxin-antitoxin system VapC family toxin -
JN995_RS13525 2930332..2930952 + 621 WP_003413441.1 DUF4178 domain-containing protein -
JN995_RS13530 2930963..2931457 + 495 WP_003413444.1 DUF2617 family protein -
JN995_RS13535 2931454..2931885 + 432 WP_003413445.1 DUF4247 domain-containing protein -
JN995_RS13540 2931910..2932368 + 459 WP_193441927.1 DUF350 domain-containing protein -
JN995_RS13545 2932365..2933936 + 1572 WP_003899392.1 polyamine aminopropyltransferase -
JN995_RS13550 2934047..2934334 + 288 WP_003413456.1 antitoxin VapB41 Antitoxin
JN995_RS13555 2934321..2934761 + 441 WP_003413460.1 type II toxin-antitoxin system VapC family toxin Toxin
JN995_RS13560 2934782..2935537 - 756 WP_003413464.1 YebC/PmpR family DNA-binding transcriptional regulator -
JN995_RS13565 2935670..2936266 - 597 WP_003413465.1 pyridoxal 5'-phosphate synthase glutaminase subunit PdxT -
JN995_RS13570 2936274..2937120 - 847 Protein_2678 acyl-CoA thioesterase II -
JN995_RS13575 2937149..2938048 - 900 WP_003413468.1 pyridoxal 5'-phosphate synthase lyase subunit PdxS -
JN995_RS13580 2938176..2938850 + 675 WP_003413471.1 pyridoxamine 5'-phosphate oxidase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain toxin

(1-146)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 147 a.a.        Molecular weight: 16026.38 Da        Isoelectric Point: 6.8599

>T289766 WP_003413460.1 NZ_LR882497:2934321-2934761 [Mycobacterium tuberculosis variant microti]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK

Download         Length: 441 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10453.98 Da        Isoelectric Point: 7.2797

>AT289766 WP_003413456.1 NZ_LR882497:2934047-2934334 [Mycobacterium tuberculosis variant microti]
MKTTLDLPDELMRAIKVRAAQQGRKMKDVVTELLRSGLSQTHSGAPIPTPRRVQLPLVHCGGAATREQEMTPERVAAALL
DQEAQWWSGHDDAAL

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQK0

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BWB8

References