Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 2872560..2873191 Replicon chromosome
Accession NZ_LR882497
Organism Mycobacterium tuberculosis variant microti strain Maus IV isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ28
Locus tag JN995_RS13280 Protein ID WP_003413174.1
Coordinates 2872814..2873191 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P95006
Locus tag JN995_RS13275 Protein ID WP_003413167.1
Coordinates 2872560..2872817 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN995_RS13245 2868474..2868788 + 315 WP_009937839.1 hypothetical protein -
JN995_RS13250 2869084..2870295 + 1212 WP_003900845.1 alpha/beta hydrolase family protein -
JN995_RS13255 2870422..2871081 + 660 WP_031719937.1 LppA family lipoprotein -
JN995_RS13260 2871078..2871740 + 663 WP_052624433.1 hypothetical protein -
JN995_RS13265 2871737..2872015 + 279 WP_003901422.1 type II toxin-antitoxin system VapB family antitoxin -
JN995_RS13270 2872108..2872521 + 414 WP_003413164.1 PIN domain nuclease -
JN995_RS13275 2872560..2872817 + 258 WP_003413167.1 ribbon-helix-helix domain-containing protein Antitoxin
JN995_RS13280 2872814..2873191 + 378 WP_003413174.1 type II toxin-antitoxin system VapC family toxin Toxin
JN995_RS13285 2873207..2873581 - 375 WP_003413177.1 hypothetical protein -
JN995_RS13290 2873681..2874076 - 396 WP_003413180.1 type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 -
JN995_RS13295 2874073..2874318 - 246 WP_003413183.1 type II toxin-antitoxin system antitoxin VapB20 -
JN995_RS13300 2874729..2875148 - 420 WP_003413190.1 A24 family peptidase -
JN995_RS13305 2875160..2875969 - 810 WP_003413193.1 shikimate dehydrogenase -
JN995_RS13310 2875966..2877234 - 1269 WP_202582048.1 endolytic transglycosylase MltG -
JN995_RS13315 2877227..2877739 - 513 WP_003413197.1 Holliday junction resolvase RuvX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(3-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(2-38)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13728.72 Da        Isoelectric Point: 4.4687

>T289764 WP_003413174.1 NZ_LR882497:2872814-2873191 [Mycobacterium tuberculosis variant microti]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY

Download         Length: 378 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9453.63 Da        Isoelectric Point: 10.6555

>AT289764 WP_003413167.1 NZ_LR882497:2872560-2872817 [Mycobacterium tuberculosis variant microti]
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGRDFTGTEYVDAIRGDLNERLA
RLGLA

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ28

Antitoxin

Source ID Structure
AlphaFold DB A0A829C9W5

References