Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN(toxin)
Location 2858220..2858860 Replicon chromosome
Accession NZ_LR882497
Organism Mycobacterium tuberculosis variant microti strain Maus IV isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TQ08
Locus tag JN995_RS13185 Protein ID WP_003412970.1
Coordinates 2858220..2858639 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TQ09
Locus tag JN995_RS13190 Protein ID WP_003412975.1
Coordinates 2858636..2858860 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN995_RS13155 2853805..2854527 - 723 WP_003412957.1 DUF1906 domain-containing protein -
JN995_RS13160 2855044..2855271 + 228 WP_003412960.1 type II toxin-antitoxin system VapB family antitoxin -
JN995_RS13165 2855268..2855669 + 402 WP_003412963.1 PIN domain-containing protein -
JN995_RS13170 2855704..2856624 - 921 WP_003412965.1 restriction endonuclease -
JN995_RS13175 2856965..2857210 - 246 WP_071854223.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
JN995_RS13180 2857269..2858219 + 951 WP_003911916.1 Lsr2 family protein -
JN995_RS13185 2858220..2858639 - 420 WP_003412970.1 type II toxin-antitoxin system VapC family toxin Toxin
JN995_RS13190 2858636..2858860 - 225 WP_003412975.1 antitoxin VapB39 Antitoxin
JN995_RS13195 2858891..2861735 - 2845 Protein_2603 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
JN995_RS13200 2861807..2862208 - 402 WP_003412981.1 hypothetical protein -
JN995_RS13205 2862208..2862678 - 471 WP_003412985.1 transcription antitermination factor NusB -
JN995_RS13210 2862681..2863244 - 564 WP_003412989.1 elongation factor P -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-128)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 14732.70 Da        Isoelectric Point: 6.7519

>T289762 WP_003412970.1 NZ_LR882497:c2858639-2858220 [Mycobacterium tuberculosis variant microti]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL

Download         Length: 420 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 7993.94 Da        Isoelectric Point: 4.0057

>AT289762 WP_003412975.1 NZ_LR882497:c2858860-2858636 [Mycobacterium tuberculosis variant microti]
MRTTLQIDDDVLEDARSIARSEGKSVGAVISELARRSLRPVGIVEVDGFPVFDVPPDAPTVTSEDVVRALEDDV

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQ08

Antitoxin

Source ID Structure
AlphaFold DB G0TQ09

References