Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2812043..2812695 | Replicon | chromosome |
| Accession | NZ_LR882497 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TPX1 |
| Locus tag | JN995_RS12990 | Protein ID | WP_003412752.1 |
| Coordinates | 2812270..2812695 (+) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ24 |
| Locus tag | JN995_RS12985 | Protein ID | WP_003412749.1 |
| Coordinates | 2812043..2812264 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN995_RS12970 | 2810283..2810489 | - | 207 | WP_003899347.1 | hypothetical protein | - |
| JN995_RS12975 | 2810625..2811248 | + | 624 | WP_202582046.1 | TIGR00725 family protein | - |
| JN995_RS12980 | 2811238..2811990 | + | 753 | WP_105799954.1 | hypothetical protein | - |
| JN995_RS12985 | 2812043..2812264 | + | 222 | WP_003412749.1 | antitoxin | Antitoxin |
| JN995_RS12990 | 2812270..2812695 | + | 426 | WP_003412752.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN995_RS12995 | 2812718..2813899 | - | 1182 | WP_003899351.1 | 2-oxo acid dehydrogenase subunit E2 | - |
| JN995_RS13000 | 2813896..2814942 | - | 1047 | WP_003412757.1 | 3-methyl-2-oxobutanoate dehydrogenase subunit beta | - |
| JN995_RS13005 | 2814953..2816056 | - | 1104 | WP_003412761.1 | pyruvate dehydrogenase (acetyl-transferring) E1 component subunit alpha | - |
| JN995_RS13010 | 2816315..2817136 | - | 822 | WP_003412766.1 | citrate (pro-3S)-lyase subunit beta | - |
| JN995_RS13015 | 2817133..2817690 | - | 558 | WP_003412768.1 | MaoC family dehydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 15392.89 Da Isoelectric Point: 9.2386
>T289761 WP_003412752.1 NZ_LR882497:2812270-2812695 [Mycobacterium tuberculosis variant microti]
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
VALLDVNALVALAWDSHIHHARIREWFTANATLGWATCPLTEAGFVRVSTNPKVLPSAIGIADARRVLVALRAVGGHRFL
ADDVSLVDDDVPLIVGYRQVTDAHLLTLARRRGVRLVTFDAGVFTLAQQRPKTPVELLTIL
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TPX1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BW03 |