Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 2258885..2259511 | Replicon | chromosome |
| Accession | NZ_LR882497 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P64926 |
| Locus tag | JN995_RS10415 | Protein ID | WP_003410075.1 |
| Coordinates | 2259113..2259511 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | JN995_RS10410 | Protein ID | WP_019283586.1 |
| Coordinates | 2258885..2259112 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN995_RS10400 | 2256924..2257268 | - | 345 | WP_003410065.1 | ferredoxin family protein | - |
| JN995_RS10405 | 2257457..2258626 | - | 1170 | WP_003899126.1 | ATP-binding protein | - |
| JN995_RS10410 | 2258885..2259112 | + | 228 | WP_019283586.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JN995_RS10415 | 2259113..2259511 | + | 399 | WP_003410075.1 | PIN domain nuclease | Toxin |
| JN995_RS10420 | 2259694..2260125 | - | 432 | WP_003410078.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| JN995_RS10425 | 2260226..2260660 | + | 435 | WP_003914358.1 | DUF1398 domain-containing protein | - |
| JN995_RS10430 | 2261097..2261276 | - | 180 | Protein_2060 | hypothetical protein | - |
| JN995_RS10435 | 2261337..2261984 | + | 648 | WP_071854215.1 | transposase | - |
| JN995_RS10440 | 2261938..2262528 | + | 591 | WP_003899131.1 | IS110 family transposase | - |
| JN995_RS10445 | 2262656..2263911 | - | 1256 | Protein_2063 | HNH endonuclease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14731.02 Da Isoelectric Point: 6.7067
>T289756 WP_003410075.1 NZ_LR882497:2259113-2259511 [Mycobacterium tuberculosis variant microti]
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
MIVDTSVWIAYLSTSESLASRWLADRIAADSTVIVPEVVMMELLIGKTDEDTAALRRRLLQRFAIEPLAPVRDAEDAAAI
HRRCRRGGDTVRSLIDCQVAAMALRIGVAVAHRDRDYEAIRTHCGLRTEPLF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|