Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 2226767..2227455 | Replicon | chromosome |
| Accession | NZ_LR882497 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P0A653 |
| Locus tag | JN995_RS10250 | Protein ID | WP_003409958.1 |
| Coordinates | 2226767..2227186 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ28 |
| Locus tag | JN995_RS10255 | Protein ID | WP_003409968.1 |
| Coordinates | 2227195..2227455 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN995_RS10225 | 2221774..2222079 | + | 306 | Protein_2019 | ABC transporter permease | - |
| JN995_RS10230 | 2222301..2223110 | + | 810 | WP_202582023.1 | class I SAM-dependent methyltransferase | - |
| JN995_RS10235 | 2223073..2224518 | - | 1446 | WP_003409946.1 | APC family permease | - |
| JN995_RS10240 | 2224697..2225383 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
| JN995_RS10245 | 2225574..2226542 | - | 969 | WP_003409956.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
| JN995_RS10250 | 2226767..2227186 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN995_RS10255 | 2227195..2227455 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| JN995_RS10260 | 2227598..2229274 | + | 1677 | WP_003899118.1 | PecA family PE domain-processing aspartic protease | - |
| JN995_RS10265 | 2229262..2229915 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
| JN995_RS10270 | 2230030..2230260 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
| JN995_RS10275 | 2230345..2231256 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
| JN995_RS10280 | 2231365..2231964 | + | 600 | WP_003409989.1 | L-lysine exporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T289753 WP_003409958.1 NZ_LR882497:c2227186-2226767 [Mycobacterium tuberculosis variant microti]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C4H9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829C483 |