Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 2217754..2218298 | Replicon | chromosome |
| Accession | NZ_LR882497 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | G0TLU9 |
| Locus tag | JN995_RS10195 | Protein ID | WP_003409896.1 |
| Coordinates | 2217754..2218050 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | P67299 |
| Locus tag | JN995_RS10200 | Protein ID | WP_003409899.1 |
| Coordinates | 2218047..2218298 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN995_RS10140 | 2212787..2213137 | - | 351 | WP_003409871.1 | hypothetical protein | - |
| JN995_RS10145 | 2213148..2214050 | - | 903 | WP_003409874.1 | hypothetical protein | - |
| JN995_RS10150 | 2214071..2214262 | - | 192 | WP_003409876.1 | hypothetical protein | - |
| JN995_RS10155 | 2214263..2214559 | - | 297 | WP_003409877.1 | hypothetical protein | - |
| JN995_RS10160 | 2214799..2215014 | + | 216 | WP_003409878.1 | antitoxin | - |
| JN995_RS10165 | 2215011..2215322 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN995_RS10170 | 2215296..2215817 | - | 522 | WP_003904745.1 | hypothetical protein | - |
| JN995_RS10175 | 2215792..2216169 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | - |
| JN995_RS10180 | 2216211..2216660 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | - |
| JN995_RS10185 | 2216657..2217202 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
| JN995_RS10190 | 2217091..2217705 | - | 615 | WP_003901296.1 | hypothetical protein | - |
| JN995_RS10195 | 2217754..2218050 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| JN995_RS10200 | 2218047..2218298 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| JN995_RS10205 | 2218285..2218779 | + | 495 | WP_003899099.1 | hypothetical protein | - |
| JN995_RS10210 | 2218939..2219346 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
| JN995_RS10215 | 2219350..2219622 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| JN995_RS10220 | 2219655..2220875 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
| JN995_RS10225 | 2221774..2222079 | + | 306 | Protein_2019 | ABC transporter permease | - |
| JN995_RS10230 | 2222301..2223110 | + | 810 | WP_202582023.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11268.64 Da Isoelectric Point: 6.8604
>T289752 WP_003409896.1 NZ_LR882497:c2218050-2217754 [Mycobacterium tuberculosis variant microti]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TLU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BUZ2 |