Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 2217754..2218298 Replicon chromosome
Accession NZ_LR882497
Organism Mycobacterium tuberculosis variant microti strain Maus IV isolate human

Toxin (Protein)


Gene name parE Uniprot ID G0TLU9
Locus tag JN995_RS10195 Protein ID WP_003409896.1
Coordinates 2217754..2218050 (-) Length 99 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P67299
Locus tag JN995_RS10200 Protein ID WP_003409899.1
Coordinates 2218047..2218298 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN995_RS10140 2212787..2213137 - 351 WP_003409871.1 hypothetical protein -
JN995_RS10145 2213148..2214050 - 903 WP_003409874.1 hypothetical protein -
JN995_RS10150 2214071..2214262 - 192 WP_003409876.1 hypothetical protein -
JN995_RS10155 2214263..2214559 - 297 WP_003409877.1 hypothetical protein -
JN995_RS10160 2214799..2215014 + 216 WP_003409878.1 antitoxin -
JN995_RS10165 2215011..2215322 + 312 WP_003409881.1 type II toxin-antitoxin system VapC family toxin -
JN995_RS10170 2215296..2215817 - 522 WP_003904745.1 hypothetical protein -
JN995_RS10175 2215792..2216169 + 378 WP_010886136.1 type II toxin-antitoxin system toxin HigB -
JN995_RS10180 2216211..2216660 + 450 WP_003409886.1 type II toxin-antitoxin system antitoxin HigA -
JN995_RS10185 2216657..2217202 + 546 WP_003409891.1 SecB-like chaperone -
JN995_RS10190 2217091..2217705 - 615 WP_003901296.1 hypothetical protein -
JN995_RS10195 2217754..2218050 - 297 WP_003409896.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
JN995_RS10200 2218047..2218298 - 252 WP_003409899.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
JN995_RS10205 2218285..2218779 + 495 WP_003899099.1 hypothetical protein -
JN995_RS10210 2218939..2219346 - 408 WP_003409913.1 type II toxin-antitoxin system VapC family toxin -
JN995_RS10215 2219350..2219622 - 273 WP_003899100.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
JN995_RS10220 2219655..2220875 - 1221 WP_003409919.1 TetR family transcriptional regulator Mce3R -
JN995_RS10225 2221774..2222079 + 306 Protein_2019 ABC transporter permease -
JN995_RS10230 2222301..2223110 + 810 WP_202582023.1 class I SAM-dependent methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-93)

Antitoxin

Antitoxin ParD

(2-80)


Sequences

Toxin        


Download         Length: 99 a.a.        Molecular weight: 11268.64 Da        Isoelectric Point: 6.8604

>T289752 WP_003409896.1 NZ_LR882497:c2218050-2217754 [Mycobacterium tuberculosis variant microti]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL

Download         Length: 297 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9207.17 Da        Isoelectric Point: 7.0150

>AT289752 WP_003409899.1 NZ_LR882497:c2218298-2218047 [Mycobacterium tuberculosis variant microti]
VGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDFDGFLGRKRADAS
RGR

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TLU9

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BUZ2

References