Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 1583476..1584131 | Replicon | chromosome |
| Accession | NZ_LR882497 | ||
| Organism | Mycobacterium tuberculosis variant microti strain Maus IV isolate human | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A7U4FAR1 |
| Locus tag | JN995_RS07350 | Protein ID | WP_003407268.1 |
| Coordinates | 1583476..1583877 (-) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TIK2 |
| Locus tag | JN995_RS07355 | Protein ID | WP_003407272.1 |
| Coordinates | 1583874..1584131 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JN995_RS07335 | 1578948..1580333 | - | 1386 | WP_003407260.1 | cytochrome P450 | - |
| JN995_RS07340 | 1580411..1581445 | + | 1035 | WP_003407264.1 | AraC family transcriptional regulator | - |
| JN995_RS07345 | 1581491..1583221 | - | 1731 | WP_031653809.1 | PE family protein | - |
| JN995_RS07350 | 1583476..1583877 | - | 402 | WP_003407268.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| JN995_RS07355 | 1583874..1584131 | - | 258 | WP_003407272.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| JN995_RS07360 | 1584214..1585173 | - | 960 | WP_003407276.1 | alpha/beta hydrolase | - |
| JN995_RS07365 | 1585198..1586160 | - | 963 | WP_003407279.1 | alpha/beta hydrolase | - |
| JN995_RS07370 | 1586159..1586896 | + | 738 | WP_031647000.1 | lysoplasmalogenase | - |
| JN995_RS07375 | 1586977..1588944 | + | 1968 | WP_105799800.1 | primosomal protein N' | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14894.39 Da Isoelectric Point: 11.6897
>T289745 WP_003407268.1 NZ_LR882497:c1583877-1583476 [Mycobacterium tuberculosis variant microti]
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
MILVDSDVLIAHLRGVVAARDWLVSARKDGPLAISVVSTAELIGGMRTAERREVWRLLASFRVQPATEVIARRAGDMMRR
YRRSHNRIGLGDYLIAATADVQGLQLATLNVWHFPMFEQLKPPFAVPGHRPRA
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FAR1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TIK2 |