Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 1242629..1243197 Replicon chromosome
Accession NZ_LR882497
Organism Mycobacterium tuberculosis variant microti strain Maus IV isolate human

Toxin (Protein)


Gene name vapC Uniprot ID G0TH08
Locus tag JN995_RS05860 Protein ID WP_003405865.1
Coordinates 1242823..1243197 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TH07
Locus tag JN995_RS05855 Protein ID WP_003405863.1
Coordinates 1242629..1242826 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JN995_RS05835 1238670..1239308 - 639 WP_003898730.1 lipid droplet-associated protein -
JN995_RS05840 1239398..1240405 + 1008 WP_003405853.1 4-hydroxy-3-methylbut-2-enyl diphosphate reductase -
JN995_RS05845 1240422..1241405 - 984 WP_003898731.1 hypothetical protein -
JN995_RS05850 1241468..1242541 + 1074 WP_105799741.1 redox-regulated ATPase YchF -
JN995_RS05855 1242629..1242826 + 198 WP_003405863.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
JN995_RS05860 1242823..1243197 + 375 WP_003405865.1 type II toxin-antitoxin system VapC family toxin Toxin
JN995_RS05865 1243400..1244098 + 699 WP_003898733.1 hypothetical protein -
JN995_RS05870 1244216..1244401 + 186 WP_003901093.1 hypothetical protein -
JN995_RS05875 1244328..1244603 - 276 WP_003405867.1 hypothetical protein -
JN995_RS05880 1244846..1245169 + 324 WP_003405871.1 antibiotic biosynthesis monooxygenase -
JN995_RS05885 1245184..1245894 - 711 WP_003911399.1 hypothetical protein -
JN995_RS05890 1245916..1246125 + 210 WP_003911400.1 hypothetical protein -
JN995_RS05895 1246077..1246784 - 708 Protein_1161 adenylate/guanylate cyclase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(2-111)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-42)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13444.56 Da        Isoelectric Point: 5.1881

>T289741 WP_003405865.1 NZ_LR882497:1242823-1243197 [Mycobacterium tuberculosis variant microti]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS

Download         Length: 375 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 6973.03 Da        Isoelectric Point: 11.7327

>AT289741 WP_003405863.1 NZ_LR882497:1242629-1242826 [Mycobacterium tuberculosis variant microti]
MRTTVTVDDALLAKAAELTGVKEKSTLLREGLQTLVRVESARRLAALGGTDPQATAAPRRRTSPR

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TH08

Antitoxin

Source ID Structure
AlphaFold DB G0TH07

References